Rat Anti-Mouse TNFα Monoclonal antibody, clone XT3.11 |
|||
CABT-L4380-1mg | Creative Diagnostics | 1 mg | EUR 1076.4 |
Human Monoclonal Laboratories manufactures the igg1κ monoclonal antibody to human tnfα reagents distributed by Genprice. The Igg1Κ Monoclonal Antibody To Human Tnfα reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Igg1Κ products are available in stock. Specificity: Igg1Κ Category: Monoclonal Group: Antibody To
Monoclonal PP2A alpha and beta Antibody |
||
Leading Biology | 0.1ml | EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 423.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 480 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 478.8 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), PE |
|||
4-MAA234Hu22-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with PE. |
Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), PE |
|||
4-MAB682Hu22-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with PE. |
Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), PE |
|||
4-MAA829Hu22-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with PE. |
Immunoglobulin G1 (IgG1) Monoclonal Antibody (Human), PE |
|||
4-MAA074Hu21-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G1 (IgG1). This antibody is labeled with PE. |
Immunoglobulin G1 (IgG1) Monoclonal Antibody (Human), PE |
|||
4-MAA074Hu22-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G1 (IgG1). This antibody is labeled with PE. |
Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), PE |
|||
4-MAA234Hu21-PE | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with PE. |
Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), APC |
|||
4-MAA234Hu21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with APC. |
Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), APC |
|||
4-MAA234Hu22-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with APC. |
Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), Cy3 |
|||
4-MAA234Hu22-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with Cy3. |
Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), HRP |
|||
4-MAA234Hu22-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with HRP. |
Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), APC |
|||
4-MAB682Hu22-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with APC. |
Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), Cy3 |
|||
4-MAB682Hu22-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with Cy3. |
Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), HRP |
|||
4-MAB682Hu22-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with HRP. |
Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), APC |
|||
4-MAA829Hu22-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with APC. |
Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), Cy3 |
|||
4-MAA829Hu22-Cy3 | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with Cy3. |
Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), HRP |
|||
4-MAA829Hu22-HRP | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with HRP. |
Immunoglobulin G1 (IgG1) Monoclonal Antibody (Human), APC |
|||
4-MAA074Hu21-APC | Cloud-Clone |
|
|
Description: A Mouse monoclonal antibody against Human Immunoglobulin G1 (IgG1). This antibody is labeled with APC. |