Rat Anti-Mouse TNFα Monoclonal antibody, clone XT3.11
CABT-L4380-1mg	Creative Diagnostics	1 mg	EUR 1076.4

Human Monoclonal Laboratories manufactures the igg1κ monoclonal antibody to human tnfα reagents distributed by Genprice. The Igg1Κ Monoclonal Antibody To Human Tnfα reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Igg1Κ products are available in stock. Specificity: Igg1Κ Category: Monoclonal Group: Antibody To

Monoclonal PP2A alpha and beta Antibody
Leading Biology	0.1ml	EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Monoclonal antibody for SUR1 and SUR2B
Stressmarq	0.1mg	EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Antibody To information

Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), PE
4-MAA234Hu22-PE	Cloud-Clone	EUR 346.80 EUR 3046.80 EUR 868.80 EUR 433.20 EUR 259.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with PE.

Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), PE
4-MAB682Hu22-PE	Cloud-Clone	EUR 356.40 EUR 3184.80 EUR 903.60 EUR 447.60 EUR 235.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with PE.

Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), PE
4-MAA829Hu22-PE	Cloud-Clone	EUR 325.20 EUR 2736.00 EUR 792.00 EUR 403.20 EUR 220.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with PE.

Immunoglobulin G1 (IgG1) Monoclonal Antibody (Human), PE
4-MAA074Hu21-PE	Cloud-Clone	EUR 352.80 EUR 3133.20 EUR 890.40 EUR 442.80 EUR 232.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G1 (IgG1). This antibody is labeled with PE.

Immunoglobulin G1 (IgG1) Monoclonal Antibody (Human), PE
4-MAA074Hu22-PE	Cloud-Clone	EUR 346.80 EUR 3046.80 EUR 868.80 EUR 433.20 EUR 230.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G1 (IgG1). This antibody is labeled with PE.

Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), PE
4-MAA234Hu21-PE	Cloud-Clone	EUR 346.80 EUR 3046.80 EUR 868.80 EUR 433.20 EUR 230.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with PE.

Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), APC
4-MAA234Hu21-APC	Cloud-Clone	EUR 403.20 EUR 3778.80 EUR 1057.20 EUR 512.40 EUR 258.00	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with APC.

Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), APC
4-MAA234Hu22-APC	Cloud-Clone	EUR 403.20 EUR 3778.80 EUR 1057.20 EUR 512.40 EUR 294.00	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with APC.

Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), Cy3
4-MAA234Hu22-Cy3	Cloud-Clone	EUR 488.40 EUR 4988.40 EUR 1359.60 EUR 633.60 EUR 343.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with Cy3.

Immunoglobulin G4 (IgG4) Monoclonal Antibody (Human), HRP
4-MAA234Hu22-HRP	Cloud-Clone	EUR 369.60 EUR 3294.00 EUR 936.00 EUR 464.40 EUR 274.80	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G4 (IgG4). This antibody is labeled with HRP.

Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), APC
4-MAB682Hu22-APC	Cloud-Clone	EUR 415.20 EUR 3951.60 EUR 1100.40 EUR 529.20 EUR 264.00	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with APC.

Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), Cy3
4-MAB682Hu22-Cy3	Cloud-Clone	EUR 504.00 EUR 5218.80 EUR 1417.20 EUR 656.40 EUR 302.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with Cy3.

Immunoglobulin G2 (IgG2) Monoclonal Antibody (Human), HRP
4-MAB682Hu22-HRP	Cloud-Clone	EUR 379.20 EUR 3444.00 EUR 973.20 EUR 478.80 EUR 248.40	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G2 (IgG2). This antibody is labeled with HRP.

Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), APC
4-MAA829Hu22-APC	Cloud-Clone	EUR 376.80 EUR 3390.00 EUR 960.00 EUR 474.00 EUR 247.20	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with APC.

Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), Cy3
4-MAA829Hu22-Cy3	Cloud-Clone	EUR 452.40 EUR 4470.00 EUR 1230.00 EUR 582.00 EUR 279.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with Cy3.

Immunoglobulin G3 (IgG3) Monoclonal Antibody (Human), HRP
4-MAA829Hu22-HRP	Cloud-Clone	EUR 345.60 EUR 2958.00 EUR 852.00 EUR 430.80 EUR 234.00	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G3 (IgG3). This antibody is labeled with HRP.

Immunoglobulin G1 (IgG1) Monoclonal Antibody (Human), APC
4-MAA074Hu21-APC	Cloud-Clone	EUR 410.40 EUR 3886.80 EUR 1083.60 EUR 523.20 EUR 261.60	100ul 10ml 1ml 200ul 20ul
Description: A Mouse monoclonal antibody against Human Immunoglobulin G1 (IgG1). This antibody is labeled with APC.