Humanized Monoclonal Antibody Treatments Tables

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Antibody Laboratories manufactures the humanized monoclonal antibody treatments tables reagents distributed by Genprice. The Humanized Monoclonal Antibody Treatments Tables reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Humanized products are available in stock. Specificity: Humanized Category: Monoclonal Group: Antibody Treatments

True north Cryobox1.5/2mLNatural

PK10
EUR 162

True north Cryobox1.5/2.0mLGreen

PK10
EUR 162

Monoclonal PP2A alpha and beta Antibody

0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Antibody Treatments information

Anti-EGFR (Panitumumab), humanized antibody

A1050-100 each
EUR 601.2

Anti-VEGF (Bevacizumab), humanized Antibody

A1045-100 each
EUR 601.2

Anti-CD20 (Obinutuzumab), Humanized Antibody

A2180-100 100 µg
EUR 612

Anti-IL-5 (Reslizumab), Humanized Antibody

A2167-100 100 µg
EUR 612

pgRNA- humanized

PVT10951 2 ug
EUR 361.2

Anti-CTLA-4 (Iplimumab), Humanized Antibody

A2110-100 100 µg
EUR 612

Anti-PD-1 (Toripalimab), Humanized Antibody

A2161-100 100 µg
EUR 612

Anti-PD-1 (Camrelizumab) humanized Antibody

A2132-100 100 µg
EUR 636

Anti-Dabigratan (Idarucizumab), Humanized Antibody

A2169-100 100 µg
EUR 612

Anti-PD-L1 (Atezolizumab), humanized Antibody

A1305-100 each
EUR 601.2

Anti-PD-1 (Pembrolizumab), humanized Antibody

A1306-100 each
EUR 601.2

Anti-PD-1 (Spartalizumab) humanized Antibody

A2131-100 100 µg
EUR 636

Anti-IL-5Rα (Benralizumab), Humanized Antibody

A2162-100 100 µg
EUR 612

Anti-IL-23α (Tildrakizumab), Humanized Antibody

A2159-100 100 µg
EUR 612

Anti-α4β7 Integrin (Vedolizumab), Humanized Antibody

A2140-100 100 µg
EUR 612

Anti-CD79B (Polatuzumab Vedotin), Humanized Antibody

A2178-100 100 µg
EUR 612

Anti-CD22 (Inotuzumab Ozogamicin), Humanized Antibody

A2179-100 100 µg
EUR 612