Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Antibody Laboratories manufactures the humanized monoclonal antibody treatments tables reagents distributed by Genprice. The Humanized Monoclonal Antibody Treatments Tables reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Humanized products are available in stock. Specificity: Humanized Category: Monoclonal Group: Antibody Treatments
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Antibody Treatments information
Anti-EGFR (Panitumumab), humanized antibody |
A1050-100 |
Biovision |
each |
EUR 601.2 |
Anti-VEGF (Bevacizumab), humanized Antibody |
A1045-100 |
Biovision |
each |
EUR 601.2 |
Anti-CD20 (Obinutuzumab), Humanized Antibody |
A2180-100 |
Biovision |
100 µg |
EUR 612 |
Anti-IL-5 (Reslizumab), Humanized Antibody |
A2167-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CTLA-4 (Iplimumab), Humanized Antibody |
A2110-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-1 (Toripalimab), Humanized Antibody |
A2161-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-1 (Camrelizumab) humanized Antibody |
A2132-100 |
Biovision |
100 µg |
EUR 636 |
Anti-Dabigratan (Idarucizumab), Humanized Antibody |
A2169-100 |
Biovision |
100 µg |
EUR 612 |
Anti-PD-L1 (Atezolizumab), humanized Antibody |
A1305-100 |
Biovision |
each |
EUR 601.2 |
Anti-PD-1 (Pembrolizumab), humanized Antibody |
A1306-100 |
Biovision |
each |
EUR 601.2 |
Anti-PD-1 (Spartalizumab) humanized Antibody |
A2131-100 |
Biovision |
100 µg |
EUR 636 |
Anti-IL-5Rα (Benralizumab), Humanized Antibody |
A2162-100 |
Biovision |
100 µg |
EUR 612 |
Anti-IL-23α (Tildrakizumab), Humanized Antibody |
A2159-100 |
Biovision |
100 µg |
EUR 612 |
Anti-α4β7 Integrin (Vedolizumab), Humanized Antibody |
A2140-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CD79B (Polatuzumab Vedotin), Humanized Antibody |
A2178-100 |
Biovision |
100 µg |
EUR 612 |
Anti-CD22 (Inotuzumab Ozogamicin), Humanized Antibody |
A2179-100 |
Biovision |
100 µg |
EUR 612 |