Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Monoclonal Laboratories manufactures the human monoclonal antibodywhat are tehy reagents distributed by Genprice. The Human Monoclonal Antibodywhat Are Tehy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibodywhat Are
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 474 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 495.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 482.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 470.4 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Antibodywhat Are information
Amphiregulin (AREG) Monoclonal Antibody (Human, Rat), APC-Cy7 |
4-MAA006Hu24-APC-Cy7 |
Cloud-Clone |
-
EUR 609.60
-
EUR 6636.00
-
EUR 1776.00
-
EUR 804.00
-
EUR 350.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human, Rat Amphiregulin (AREG). This antibody is labeled with APC-Cy7. |
Amphiregulin (AREG) Monoclonal Antibody (Human, Rat), Biotinylated |
4-MAA006Hu24-Biotin |
Cloud-Clone |
-
EUR 345.60
-
EUR 2556.00
-
EUR 774.00
-
EUR 417.60
-
EUR 250.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human, Rat Amphiregulin (AREG). This antibody is labeled with Biotin. |
Human IGF-I monoclonal antibody |
MAM1 |
GroPep |
500 µg |
EUR 358.8 |
Human TGF-β2 monoclonal antibody |
MAB1 |
GroPep |
500 µg |
EUR 358.8 |
Pepsin (PP) Monoclonal Antibody (Human) |
4-MAA632Hu22 |
Cloud-Clone |
-
EUR 310.80
-
EUR 3249.60
-
EUR 804.00
-
EUR 393.60
-
EUR 262.80
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Pepsin (PP) |
Titin (TTN) Monoclonal Antibody (Human) |
4-MAB667Hu21 |
Cloud-Clone |
-
EUR 260.40
-
EUR 2457.60
-
EUR 624.00
-
EUR 321.60
-
EUR 241.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Titin (TTN) |
Klotho (KL) Monoclonal Antibody (Human) |
4-MAH757Hu21 |
Cloud-Clone |
-
EUR 306.00
-
EUR 3170.40
-
EUR 786.00
-
EUR 386.40
-
EUR 260.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Klotho (KL) |
Human IGFBP-3 monoclonal antibody |
MAK1 |
GroPep |
200 µg |
EUR 358.8 |
Zyxin (ZYX) Monoclonal Antibody (Human) |
4-MAC235Hu21 |
Cloud-Clone |
-
EUR 306.00
-
EUR 3170.40
-
EUR 786.00
-
EUR 386.40
-
EUR 260.40
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Zyxin (ZYX) |
Monoclonal Human IgM Antibody |
AMM03207G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human Human IgM. The antibodies are raised in Mouse. |
Midkine (MK) Monoclonal Antibody (Human) |
4-MAA631Hu22 |
Cloud-Clone |
-
EUR 289.20
-
EUR 2900.40
-
EUR 724.80
-
EUR 361.20
-
EUR 253.20
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Midkine (MK) |
Leptin (LEP) Monoclonal Antibody (Human) |
4-MAA084Hu21 |
Cloud-Clone |
-
EUR 285.60
-
EUR 2845.20
-
EUR 711.60
-
EUR 356.40
-
EUR 252.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Leptin (LEP) |
Leptin (LEP) Monoclonal Antibody (Human) |
4-MAA084Hu22 |
Cloud-Clone |
-
EUR 285.60
-
EUR 2845.20
-
EUR 711.60
-
EUR 356.40
-
EUR 252.00
|
- 100ul
- 10ml
- 1ml
- 200ul
- 20ul
|
|
Description: A Mouse monoclonal antibody against Human Leptin (LEP) |