Human Monoclonal Antibodywhat Are Tehy

Monoclonal PP2A alpha and beta Antibody
AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal antibodywhat are tehy reagents distributed by Genprice. The Human Monoclonal Antibodywhat Are Tehy reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibodywhat Are

JBS True Blue
300 µl
EUR 16
Description: JBS True Blue

Monoclonal PP2A alpha and beta Antibody
0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 480
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565.

Monoclonal antibody for SUR1 and SUR2B
0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594.

Antibodywhat Are information

Amphiregulin (AREG) Monoclonal Antibody (Human, Rat), APC-Cy7
4-MAA006Hu24-APC-Cy7
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human, Rat Amphiregulin (AREG). This antibody is labeled with APC-Cy7.

Amphiregulin (AREG) Monoclonal Antibody (Human, Rat), Biotinylated
4-MAA006Hu24-Biotin
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • Ask for price
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human, Rat Amphiregulin (AREG). This antibody is labeled with Biotin.

S100A8, human Monoclonal Antibody
MBS668017-01mg 0.1mg
EUR 350

S100A8, human Monoclonal Antibody
MBS668017-5x01mg 5x0.1mg
EUR 1570

S100A8, human Monoclonal Antibody
MBS668017-0025mg 0.025mg
EUR 185

S100A8, human Monoclonal Antibody
MBS668174-0025mg 0.025mg
EUR 185

S100A8, human Monoclonal Antibody
MBS668174-01mg 0.1mg
EUR 350

S100A8, human Monoclonal Antibody
MBS668174-5x01mg 5x0.1mg
EUR 1570

Human CD8 Monoclonal antibody
8F1-100T 100 test
EUR 215.6

Human CD8 Monoclonal antibody
8PE1-100T 100 test
EUR 237.6

Human CD8 Monoclonal antibody
8PPC5.5-100T 100 test
EUR 358.6

Human CD8 Monoclonal antibody
8A1-100T 100 test
EUR 259.6

Human CD8 Monoclonal antibody
8AC750-100T 100 test
EUR 446.6

Human CD5 Monoclonal antibody
5A-100T 100 test
EUR 276.1

Human CD5 Monoclonal antibody
5A1-100T 100 test
EUR 248.6

Human CD5 Monoclonal antibody
5F-100T 100 test
EUR 221.1

Human CD5 Monoclonal antibody
5F1-100T 100 test
EUR 204.6
September 2024
M D M D F S S
 1
2345678
9101112131415
16171819202122
23242526272829
30