Human Monoclonal Antibody Treatements

Monoclonal antibody for SUR1 and SUR2B

SMC-432D 0.1mg
EUR 423.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated.

Human Antibody Laboratories manufactures the human monoclonal antibody treatements reagents distributed by Genprice. The Human Monoclonal Antibody Treatements reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Treatements

True Blue Chloride

100mg
EUR 11200
Description: 71431-30-6

True north Cryobox1.5/2mLNatural

PK10
EUR 129.6

True Blue Diaceturate Salt

100mg
EUR 15000
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

1mg Ask for price
Description: 108321-12-6

True Blue (TB) Diaceturate Salt

5mg Ask for price
Description: 108321-12-6

Porcine True insulin ELISA kit

96T
EUR 700
Description: ELISA

Goat True insulin ELISA kit

96T
EUR 700
Description: ELISA

Antibody Treatements information

Human CD9 Monoclonal antibody

9CFB-100T 100 test
EUR 292.6

Human CD9 Monoclonal antibody

9F-100T 100 test
EUR 215.6

Human CD9 Monoclonal antibody

9PE-100T 100 test
EUR 259.6

Human CD9 Monoclonal antibody

9PU-01MG 0,1 mg
EUR 149.6

Human CD4 Monoclonal antibody

4A-100T 100 test
EUR 259.6

Human CD4 Monoclonal antibody

4AC750-100T 100 test
EUR 457.6

Human CD4 Monoclonal antibody

4CFB-100T 100 test
EUR 292.6

Human CD4 Monoclonal antibody

4F-100T 100 test
EUR 215.6

Human CD4 Monoclonal antibody

4PE-100T 100 test
EUR 266.2

Human CD4 Monoclonal antibody

4PP-100T 100 test
EUR 290.4

Human CD4 Monoclonal antibody

4PPC5.5-100T 100 test
EUR 292.6

Human CD6 Monoclonal antibody

6A-100T 100 test
EUR 259.6

Human CD6 Monoclonal antibody

6F-100T 100 test
EUR 215.6

Human CD6 Monoclonal antibody

6PE-100T 100 test
EUR 259.6

Human CD5 Monoclonal antibody

5A-100T 100 test
EUR 276.1

Human CD5 Monoclonal antibody

5A1-100T 100 test
EUR 248.6

Human CD5 Monoclonal antibody

5F-100T 100 test
EUR 221.1