Monoclonal antibody for SUR1 and SUR2B |
SMC-432D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Human Monoclonal Laboratories manufactures the human monoclonal antibody therapeutics reagents distributed by Genprice. The Human Monoclonal Antibody Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Therapeutics
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 594. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Antibody Therapeutics information
Anti-SARS-CoV-2, Biosimilar of Therapeutic Antibody |
MBS434345-005mg |
MyBiosource |
0.05mg |
EUR 305 |
Anti-SARS-CoV-2, Biosimilar of Therapeutic Antibody |
MBS434345-5x005mg |
MyBiosource |
5x0.05mg |
EUR 1230 |
Anti-P.aeruginosa exopolysaccharide Psl Therapeutic Antibody |
TRI-AB-052 |
TRI Biotech |
0.1mg |
EUR 1620 |
Recombinant Human ACVR2B, Fc-tagged therapeutic protein |
ACVR2B-P014H |
Creative BioMart |
100ug |
EUR 958.4 |
|
Therapeutic agent-1 |
HY-153592 |
MedChemExpress |
10 mg |
EUR 54.11 |
Description: Therapeutic agent-1 is a heteroaryl compound that can be used in Gaucher disease glucocerebrosidase activity enzyme replacement therapy[1]. |
Recombinant Human ActRIIA therapeutic protein, Fc-tagged |
ACVR2A-P015H |
Creative BioMart |
100ug |
EUR 958.4 |
|
CeraVe Therapeutic Hand Cream , 3 Oz |
LC3035-001 |
GenDepot |
Ea |
EUR 84 |
Recombinant Hu-rhEGF-rP64k/Mont Therapeutic Vaccine |
THP-0327 |
Creative BioMart |
1 vial |
EUR 2398.4 |
Description: Protein |
S100A8, human Monoclonal Antibody |
MBS668017-0025mg |
MyBiosource |
0.025mg |
EUR 185 |
S100A8, human Monoclonal Antibody |
MBS668017-01mg |
MyBiosource |
0.1mg |
EUR 350 |
S100A8, human Monoclonal Antibody |
MBS668017-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1570 |
S100A8, human Monoclonal Antibody |
MBS668174-0025mg |
MyBiosource |
0.025mg |
EUR 185 |
S100A8, human Monoclonal Antibody |
MBS668174-01mg |
MyBiosource |
0.1mg |
EUR 350 |
S100A8, human Monoclonal Antibody |
MBS668174-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1570 |
Human CD8 Monoclonal antibody |
8A1-100T |
ImmunoStep |
100 test |
EUR 259.6 |
Human CD8 Monoclonal antibody |
8AC750-100T |
ImmunoStep |
100 test |
EUR 446.6 |
Human CD8 Monoclonal antibody |
8F1-100T |
ImmunoStep |
100 test |
EUR 215.6 |