Monoclonal PP2A alpha and beta Antibody |
|
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
|
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Human Monoclonal Laboratories manufactures the human monoclonal antibody therapeutics reagents distributed by Genprice. The Human Monoclonal Antibody Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Therapeutics
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 471.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Antibody Therapeutics information
Recombinant Human CSF3 therapeutic protein |
|
CSF3-P054H |
Creative BioMart |
20ug |
EUR 158.4 |
|
|
|
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Recombinant Human IDUA therapeutic protein |
|
IDUA-P025H |
Creative BioMart |
5ug |
EUR 238.4 |
|
|
|
Description: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Anti-P.aeruginosa exopolysaccharide Psl Therapeutic Antibody |
|
TRI-AB-052 |
TRI Biotech |
0.1mg |
EUR 1620 |
Therapeutic agent-1 |
|
HY-153592 |
MedChemExpress |
10 mg |
EUR 54.11 |
|
Description: Therapeutic agent-1 is a heteroaryl compound that can be used in Gaucher disease glucocerebrosidase activity enzyme replacement therapy[1]. |
Recombinant Human ACVR2B, Fc-tagged therapeutic protein |
|
ACVR2B-P014H |
Creative BioMart |
100ug |
EUR 958.4 |
|
|
Recombinant Human ActRIIA therapeutic protein, Fc-tagged |
|
ACVR2A-P015H |
Creative BioMart |
100ug |
EUR 958.4 |
|
|
CeraVe Therapeutic Hand Cream , 3 Oz |
|
LC3035-001 |
GenDepot |
Ea |
EUR 84 |
Recombinant Hu-rhEGF-rP64k/Mont Therapeutic Vaccine |
|
THP-0327 |
Creative BioMart |
1 vial |
EUR 2398.4 |
|
Description: Protein |
S100A8, human Monoclonal Antibody |
|
MBS668017-01mg |
MyBiosource |
0.1mg |
EUR 350 |
S100A8, human Monoclonal Antibody |
|
MBS668017-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1570 |
S100A8, human Monoclonal Antibody |
|
MBS668017-0025mg |
MyBiosource |
0.025mg |
EUR 185 |
S100A8, human Monoclonal Antibody |
|
MBS668174-0025mg |
MyBiosource |
0.025mg |
EUR 185 |
S100A8, human Monoclonal Antibody |
|
MBS668174-01mg |
MyBiosource |
0.1mg |
EUR 350 |
S100A8, human Monoclonal Antibody |
|
MBS668174-5x01mg |
MyBiosource |
5x0.1mg |
EUR 1570 |
Human CD8 Monoclonal antibody |
|
8F1-100T |
ImmunoStep |
100 test |
EUR 215.6 |
Human CD8 Monoclonal antibody |
|
8PE1-100T |
ImmunoStep |
100 test |
EUR 237.6 |
Human CD8 Monoclonal antibody |
|
8PPC5.5-100T |
ImmunoStep |
100 test |
EUR 358.6 |
