Human Monoclonal Antibody Therapeutics

Monoclonal PP2A alpha and beta Antibody

AMM03147G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP

Human Monoclonal Laboratories manufactures the human monoclonal antibody therapeutics reagents distributed by Genprice. The Human Monoclonal Antibody Therapeutics reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Antibody Therapeutics

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Antibody Therapeutics information

Visfatin (VF) Monoclonal Antibody (Human)

4-MAA638Hu22
  • EUR 289.20
  • EUR 2900.40
  • EUR 724.80
  • EUR 361.20
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Visfatin (VF)

Albumin (ALB) Monoclonal Antibody (Human)

4-MAB028Hu22
  • EUR 265.20
  • EUR 2536.80
  • EUR 642.00
  • EUR 328.80
  • EUR 243.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Albumin (ALB)

Relaxin (RLN) Monoclonal Antibody (Human)

4-MAB216Hu22
  • EUR 296.40
  • EUR 3027.60
  • EUR 753.60
  • EUR 373.20
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Relaxin (RLN)

Elastin (ELN) Monoclonal Antibody (Human)

4-MAB337Hu21
  • EUR 296.40
  • EUR 3027.60
  • EUR 753.60
  • EUR 373.20
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Elastin (ELN)

Lumican (LUM) Monoclonal Antibody (Human)

4-MAB496Hu22
  • EUR 296.40
  • EUR 3027.60
  • EUR 753.60
  • EUR 373.20
  • EUR 256.80
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Lumican (LUM)

Motilin (MTL) Monoclonal Antibody (Human)

4-MAA575Hu21
  • EUR 271.20
  • EUR 2616.00
  • EUR 660.00
  • EUR 336.00
  • EUR 246.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Motilin (MTL)

Reelin (RELN) Monoclonal Antibody (Human)

4-MAC775Hu21
  • EUR 308.40
  • EUR 3217.20
  • EUR 796.80
  • EUR 390.00
  • EUR 261.60
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Reelin (RELN)

Mouse Anti Human C6 Monoclonal Antibody

CABT-45021MH 0.1 mg
EUR 1008

Mouse Anti Human C5 Monoclonal Antibody

CABT-47920MH 0.1 mg
EUR 1008

Mouse Anti Human C7 Monoclonal Antibody

CABT-47921MH 0.1 mg
EUR 1008

Mouse Anti Human C8 Monoclonal Antibody

CABT-47922MH 0.1 mg
EUR 1008

Mouse Anti Human C9 Monoclonal Antibody

CABT-47923MH 0.1 mg
EUR 1008

Monoclonal SirT1 monoclonal antibody

APR09951G 0.05mg
EUR 580.8
Description: A Monoclonal antibody against Human SirT1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Monoclonal SirT1 monoclonal antibody

APR09952G 0.1ml
EUR 580.8
Description: A Monoclonal antibody against Human SirT1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB

Monoclonal HDAC2 monoclonal antibody

AMM00031G 0.05mg
EUR 633.6
Description: A Monoclonal antibody against Human HDAC2 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF

Ubiquitin (Ub) Monoclonal Antibody (Human)

4-MAA164Hu21
  • EUR 289.20
  • EUR 2900.40
  • EUR 724.80
  • EUR 361.20
  • EUR 253.20
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Ubiquitin (Ub)

Copeptin (CPP) Monoclonal Antibody (Human)

4-MAA365Hu28
  • EUR 301.20
  • EUR 3091.20
  • EUR 768.00
  • EUR 379.20
  • EUR 258.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
Description: A Mouse monoclonal antibody against Human Copeptin (CPP)