Monoclonal PP2A alpha and beta Antibody |
AMM03147G |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Borrelia Antibody Laboratories manufactures the borrelia monoclonal antibody tick reagents distributed by Genprice. The Borrelia Monoclonal Antibody Tick reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact borrelia Antibody. Other Borrelia products are available in stock. Specificity: Borrelia Category: Monoclonal Group: Antibody Tick
Monoclonal PP2A alpha and beta Antibody |
Leading Biology |
0.1ml |
EUR 580.8 |
Description: A Monoclonal antibody against Human PP2A alpha and beta. The antibodies are raised in Mouse. This antibody is applicable in WB, IP |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 423.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is not conjugated. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 480 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 390. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 488. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 565. |
Antibody Tick information
Borrelia burgdorferi Flagellar Antigen Antibody |
abx411172-02mg |
Abbexa |
0.2 mg |
EUR 678 |
|
Pan Borrelia (Borrelia spp.) RT PCR kit |
RTq-VH740-100D |
Bioingentech |
100T |
EUR 860.4 |
Pan Borrelia (Borrelia spp.) RT PCR kit |
RTq-VH740-150D |
Bioingentech |
150T |
EUR 969.6 |
Pan Borrelia (Borrelia spp.) RT PCR kit |
RTq-VH740-50D |
Bioingentech |
50T |
EUR 717.6 |
Mouse antibody for Borrelia burgdorferi Osp B |
561 |
Virostat |
100 ug |
EUR 386.26 |
Description: This is purified Mouse monoclonal antibody against Borrelia burgdorferi Osp B for WB, ELISA. |
Mouse antibody for Borrelia burgdorferi Osp A |
551 |
Virostat |
100 ug |
EUR 386.26 |
Description: This is purified Mouse monoclonal antibody against Borrelia burgdorferi Osp A for WB, ELISA. |
Borrelia burgdorferi (B. burgdorferi) Antibody (FITC) |
abx411174-1ml |
Abbexa |
1 ml |
EUR 610.8 |
|
Human Borrelia burgdorferi Antibody IgG ELISA Kit |
abx159290-96tests |
Abbexa |
96 tests |
EUR 1515.6 |
|
Rabbit Anti Borrelia Burgdorferi Polyclonal Antibody |
DPBT-66813RB |
Creative Diagnostics |
1 ml |
EUR 920.4 |
Monoclonal GR monoclonal antibody |
AMM00029G |
Leading Biology |
0.05mg |
EUR 633.6 |
Description: A Monoclonal antibody against Human GR monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB, FC, E, IP |
Pan Borrelia (Borrelia spp.) One-Step PCR kit |
Oneq-VH740-100D |
Bioingentech |
100T |
EUR 1039.2 |
Pan Borrelia (Borrelia spp.) One-Step PCR kit |
Oneq-VH740-150D |
Bioingentech |
150T |
EUR 1177.2 |
Pan Borrelia (Borrelia spp.) One-Step PCR kit |
Oneq-VH740-50D |
Bioingentech |
50T |
EUR 861.6 |
Mouse Anti-Borrelia burgdorferi sensu stricto Monoclonal Antibody |
DMAB3060 |
Creative Diagnostics |
1 mg |
EUR 889.2 |
Monoclonal TBP monoclonal antibody |
APR13720G |
Leading Biology |
0.1ml |
EUR 633.6 |
Description: A Monoclonal antibody against Human TBP monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB |
Monoclonal Rsf1 monoclonal antibody |
AMM07673G |
Leading Biology |
0.05mg |
EUR 633.6 |
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP |
Monoclonal Rsf1 monoclonal antibody |
AMM07674G |
Leading Biology |
0.1ml |
EUR 633.6 |
Description: A Monoclonal antibody against Human Rsf1 monoclonal. The antibodies are raised in Mouse. This antibody is applicable in WB and IF, IP |