Thyroid medullary cancer tissue array and normal tissues |
TH806 |
TissueArray |
each |
EUR 306 |
Description: Thyroid medullary cancer tissue array and normal tissues, 40 cases/80 cores, with grade and stage data |
Human Monoclonal Laboratories manufactures the a monoclonal antibody to human dlk1 reveals differential expression in cancer and absence in healthy tissues reagents distributed by Genprice. The A Monoclonal Antibody To Human Dlk1 Reveals Differential Expression In Cancer And Absence In Healthy Tissues reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other A products are available in stock. Specificity: A Category: Monoclonal Group: Antibody To
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 478.8 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 471.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 477.6 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
Stressmarq |
0.1mg |
EUR 564 |
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 (VHTILTADLVIVMKRGNILEYDTPESLLAQEDGVFASFVRADM, cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Antibody To information
Mouse Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E03S0021-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Mouse Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E04S0021-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E04S0021-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E04S0021-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E05S0021-192T |
BlueGene |
192 tests |
EUR 1524 |
|
Description: A competitive ELISA for quantitative measurement of Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E05S0021-48 |
BlueGene |
1 plate of 48 wells |
EUR 624 |
|
Description: A competitive ELISA for quantitative measurement of Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit |
E05S0021-96 |
BlueGene |
1 plate of 96 wells |
EUR 822 |
|
Description: A competitive ELISA for quantitative measurement of Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species. |
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody |
20-abx318077 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody |
abx232325-100ug |
Abbexa |
100 ug |
EUR 577.2 |
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody |
20-abx112066 |
Abbexa |
|
|
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody |
abx028902-400ul |
Abbexa |
400 ul |
EUR 627.6 |
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody |
abx028902-80l |
Abbexa |
80 µl |
EUR 343.2 |
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody |
abx430013-200ul |
Abbexa |
200 ul |
EUR 460.8 |
|
Differentially Expressed In FDCP 8 Homolog (DEF8) Antibody |
20-abx308147 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody (HRP) |
20-abx315526 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Differentially Expressed In FDCP 8 Homolog (DEF8) Antibody (HRP) |
20-abx308148 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|
Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody (FITC) |
20-abx315527 |
Abbexa |
-
EUR 493.20
-
EUR 2214.00
-
EUR 718.80
-
EUR 218.40
-
EUR 360.00
|
- 100 ug
- 1 mg
- 200 ug
- 20 ug
- 50 ug
|
|