A Monoclonal Antibody To Human Dlk1 Reveals Differential Expression In Cancer And Absence In Healthy Tissues

Thyroid medullary cancer tissue array and normal tissues

TH806 each
EUR 306
Description: Thyroid medullary cancer tissue array and normal tissues, 40 cases/80 cores, with grade and stage data

Human Monoclonal Laboratories manufactures the a monoclonal antibody to human dlk1 reveals differential expression in cancer and absence in healthy tissues reagents distributed by Genprice. The A Monoclonal Antibody To Human Dlk1 Reveals Differential Expression In Cancer And Absence In Healthy Tissues reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human monoclonal. Other A products are available in stock. Specificity: A Category: Monoclonal Group: Antibody To

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 633.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 655.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 680.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 478.8
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with ATTO 700.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Antibody To information

Mouse Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E03S0021-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Mouse Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E04S0021-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E04S0021-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E04S0021-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Rabbit Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E05S0021-192T 192 tests
EUR 1524
Description: A competitive ELISA for quantitative measurement of Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E05S0021-48 1 plate of 48 wells
EUR 624
Description: A competitive ELISA for quantitative measurement of Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 ELISA kit

E05S0021-96 1 plate of 96 wells
EUR 822
Description: A competitive ELISA for quantitative measurement of Guinea pig Spondin 2/Mindin/Differentially expressed in cancerous and non cancerous lung cells 1 in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody

20-abx318077
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody

abx232325-100ug 100 ug
EUR 577.2

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody

20-abx112066
  • EUR 878.40
  • EUR 477.60
  • 150 ul
  • 50 ul

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody

abx028902-400ul 400 ul
EUR 627.6

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody

abx028902-80l 80 µl
EUR 343.2

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody

abx430013-200ul 200 ul
EUR 460.8

Differentially Expressed In FDCP 8 Homolog (DEF8) Antibody

20-abx308147
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody (HRP)

20-abx315526
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Differentially Expressed In FDCP 8 Homolog (DEF8) Antibody (HRP)

20-abx308148
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug

Differentially Expressed In FDCP 6 Homolog (DEF6) Antibody (FITC)

20-abx315527
  • EUR 493.20
  • EUR 2214.00
  • EUR 718.80
  • EUR 218.40
  • EUR 360.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug